ASCL1 monoclonal antibody (M02), clone 2D9
  • ASCL1 monoclonal antibody (M02), clone 2D9

ASCL1 monoclonal antibody (M02), clone 2D9

Ref: AB-H00000429-M02
ASCL1 monoclonal antibody (M02), clone 2D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASCL1.
Información adicional
Size 100 ug
Gene Name ASCL1
Gene Alias ASH1|HASH1|MASH1|bHLHa46
Gene Description achaete-scute complex homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 429
Clone Number 2D9
Iso type IgG2b Kappa

Enviar uma mensagem


ASCL1 monoclonal antibody (M02), clone 2D9

ASCL1 monoclonal antibody (M02), clone 2D9