ARVCF monoclonal antibody (M01), clone 5D2
  • ARVCF monoclonal antibody (M01), clone 5D2

ARVCF monoclonal antibody (M01), clone 5D2

Ref: AB-H00000421-M01
ARVCF monoclonal antibody (M01), clone 5D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARVCF.
Información adicional
Size 100 ug
Gene Name ARVCF
Gene Alias FLJ35345
Gene Description armadillo repeat gene deletes in velocardiofacial syndrome
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARVCF (NP_001661, 863 a.a. ~ 962 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 421
Clone Number 5D2
Iso type IgG1 Kappa

Enviar uma mensagem


ARVCF monoclonal antibody (M01), clone 5D2

ARVCF monoclonal antibody (M01), clone 5D2