ARSB monoclonal antibody (M10), clone 2G6
  • ARSB monoclonal antibody (M10), clone 2G6

ARSB monoclonal antibody (M10), clone 2G6

Ref: AB-H00000411-M10
ARSB monoclonal antibody (M10), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARSB.
Información adicional
Size 100 ug
Gene Name ARSB
Gene Alias ASB|G4S|MPS6
Gene Description arylsulfatase B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARSB (NP_942002, 166 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 411
Clone Number 2G6
Iso type IgG1 Kappa

Enviar uma mensagem


ARSB monoclonal antibody (M10), clone 2G6

ARSB monoclonal antibody (M10), clone 2G6