RHOH polyclonal antibody (A01)
  • RHOH polyclonal antibody (A01)

RHOH polyclonal antibody (A01)

Ref: AB-H00000399-A01
RHOH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RHOH.
Información adicional
Size 50 uL
Gene Name RHOH
Gene Alias ARHH|TTF
Gene Description ras homolog gene family, member H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RHOH (AAH14261.1, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 399

Enviar uma mensagem


RHOH polyclonal antibody (A01)

RHOH polyclonal antibody (A01)