ARHGDIG polyclonal antibody (A01)
  • ARHGDIG polyclonal antibody (A01)

ARHGDIG polyclonal antibody (A01)

Ref: AB-H00000398-A01
ARHGDIG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ARHGDIG.
Información adicional
Size 50 uL
Gene Name ARHGDIG
Gene Alias RHOGDI-3
Gene Description Rho GDP dissociation inhibitor (GDI) gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGDIG (AAH47699, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 398

Enviar uma mensagem


ARHGDIG polyclonal antibody (A01)

ARHGDIG polyclonal antibody (A01)