ARHGDIA MaxPab rabbit polyclonal antibody (D01)
  • ARHGDIA MaxPab rabbit polyclonal antibody (D01)

ARHGDIA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000396-D01
ARHGDIA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein.
Información adicional
Size 100 uL
Gene Name ARHGDIA
Gene Alias GDIA1|MGC117248|RHOGDI|RHOGDI-1
Gene Description Rho GDP dissociation inhibitor (GDI) alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGDIA (NP_004300.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 396

Enviar uma mensagem


ARHGDIA MaxPab rabbit polyclonal antibody (D01)

ARHGDIA MaxPab rabbit polyclonal antibody (D01)