Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ABCC6 monoclonal antibody (M01), clone 1E6
Abnova
ABCC6 monoclonal antibody (M01), clone 1E6
Ref: AB-H00000368-M01
ABCC6 monoclonal antibody (M01), clone 1E6
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ABCC6.
Información adicional
Size
100 ug
Gene Name
ABCC6
Gene Alias
ABC34|ARA|EST349056|MLP1|MOATE|MRP6|PXE|PXE1
Gene Description
ATP-binding cassette, sub-family C (CFTR/MRP), member 6
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
368
Clone Number
1E6
Iso type
IgG2b Kappa
Enviar uma mensagem
ABCC6 monoclonal antibody (M01), clone 1E6
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*