FASLG MaxPab mouse polyclonal antibody (B01)
  • FASLG MaxPab mouse polyclonal antibody (B01)

FASLG MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00000356-B01
FASLG MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human FASLG protein.
Información adicional
Size 50 uL
Gene Name FASLG
Gene Alias APT1LG1|CD178|CD95L|FASL|TNFSF6
Gene Description Fas ligand (TNF superfamily, member 6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FASLG (NP_000630, 1 a.a. ~ 281 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 356

Enviar uma mensagem


FASLG MaxPab mouse polyclonal antibody (B01)

FASLG MaxPab mouse polyclonal antibody (B01)