FAS monoclonal antibody (M01A), clone 5B4
  • FAS monoclonal antibody (M01A), clone 5B4

FAS monoclonal antibody (M01A), clone 5B4

Ref: AB-H00000355-M01A
FAS monoclonal antibody (M01A), clone 5B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FAS.
Información adicional
Size 200 uL
Gene Name FAS
Gene Alias ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6
Gene Description Fas (TNF receptor superfamily, member 6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 355
Clone Number 5B4
Iso type IgG1 Kappa

Enviar uma mensagem


FAS monoclonal antibody (M01A), clone 5B4

FAS monoclonal antibody (M01A), clone 5B4