Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
FAS monoclonal antibody (M01), clone 5B4
Abnova
FAS monoclonal antibody (M01), clone 5B4
Ref: AB-H00000355-M01
FAS monoclonal antibody (M01), clone 5B4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant FAS.
Información adicional
Size
50 ug
Gene Name
FAS
Gene Alias
ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6
Gene Description
Fas (TNF receptor superfamily, member 6)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
355
Clone Number
5B4
Iso type
IgG1 Kappa
Enviar uma mensagem
FAS monoclonal antibody (M01), clone 5B4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*