Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
APOC4 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
APOC4 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000346-D01P
APOC4 purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human APOC4 protein.
Información adicional
Size
100 ug
Gene Name
APOC4
Gene Alias
-
Gene Description
apolipoprotein C-IV
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr
Immunogen Prot. Seq
MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
APOC4 (NP_001637.1, 1 a.a. ~ 127 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
346
Enviar uma mensagem
APOC4 purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*