APOC1 polyclonal antibody (A01)
  • APOC1 polyclonal antibody (A01)

APOC1 polyclonal antibody (A01)

Ref: AB-H00000341-A01
APOC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant APOC1.
Información adicional
Size 50 uL
Gene Name APOC1
Gene Alias -
Gene Description apolipoprotein C-I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOC1 (AAH09698, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 341

Enviar uma mensagem


APOC1 polyclonal antibody (A01)

APOC1 polyclonal antibody (A01)