Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
APOA2 monoclonal antibody (M01), clone 4F3
Abnova
APOA2 monoclonal antibody (M01), clone 4F3
Ref: AB-H00000336-M01
APOA2 monoclonal antibody (M01), clone 4F3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant APOA2.
Información adicional
Size
100 ug
Gene Name
APOA2
Gene Alias
-
Gene Description
apolipoprotein A-II
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
336
Clone Number
4F3
Iso type
IgG1 kappa
Enviar uma mensagem
APOA2 monoclonal antibody (M01), clone 4F3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*