APOA1 polyclonal antibody (A01)
  • APOA1 polyclonal antibody (A01)

APOA1 polyclonal antibody (A01)

Ref: AB-H00000335-A01
APOA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant APOA1.
Información adicional
Size 50 uL
Gene Name APOA1
Gene Alias MGC117399
Gene Description apolipoprotein A-I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 335

Enviar uma mensagem


APOA1 polyclonal antibody (A01)

APOA1 polyclonal antibody (A01)