APLP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • APLP2 purified MaxPab rabbit polyclonal antibody (D01P)

APLP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000334-D01P
APLP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human APLP2 protein.
Información adicional
Size 100 ug
Gene Name APLP2
Gene Alias APPH|APPL2|CDEBP
Gene Description amyloid beta (A4) precursor-like protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APLP2 (AAH04371.1, 1 a.a. ~ 522 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 334

Enviar uma mensagem


APLP2 purified MaxPab rabbit polyclonal antibody (D01P)

APLP2 purified MaxPab rabbit polyclonal antibody (D01P)