BIRC5 monoclonal antibody (M01), clone 5B10
  • BIRC5 monoclonal antibody (M01), clone 5B10

BIRC5 monoclonal antibody (M01), clone 5B10

Ref: AB-H00000332-M01
BIRC5 monoclonal antibody (M01), clone 5B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BIRC5.
Información adicional
Size 100 ug
Gene Name BIRC5
Gene Alias API4|EPR-1
Gene Description baculoviral IAP repeat-containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BIRC5 (NP_001159, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 332
Clone Number 5B10
Iso type IgG2a Kappa

Enviar uma mensagem


BIRC5 monoclonal antibody (M01), clone 5B10

BIRC5 monoclonal antibody (M01), clone 5B10