Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
Abnova
APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
Ref: AB-H00000328-D02P
APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human APEX1 protein.
Información adicional
Size
100 ug
Gene Name
APEX1
Gene Alias
APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1
Gene Description
APEX nuclease (multifunctional DNA repair enzyme) 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,IF
Immunogen Prot. Seq
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRH
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
328
Enviar uma mensagem
APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*