Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
APCS monoclonal antibody (M11), clone 4F3
Abnova
APCS monoclonal antibody (M11), clone 4F3
Ref: AB-H00000325-M11
APCS monoclonal antibody (M11), clone 4F3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant APCS.
Información adicional
Size
100 ug
Gene Name
APCS
Gene Alias
MGC88159|PTX2|SAP
Gene Description
amyloid P component, serum
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
VTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
APCS (AAH07058.1, 35 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
325
Clone Number
4F3
Iso type
IgG2a Kappa
Enviar uma mensagem
APCS monoclonal antibody (M11), clone 4F3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*