NUDT2 monoclonal antibody (M01), clone 4A4-3C3
  • NUDT2 monoclonal antibody (M01), clone 4A4-3C3

NUDT2 monoclonal antibody (M01), clone 4A4-3C3

Ref: AB-H00000318-M01
NUDT2 monoclonal antibody (M01), clone 4A4-3C3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NUDT2.
Información adicional
Size 100 ug
Gene Name NUDT2
Gene Alias APAH1|MGC10404
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 318
Clone Number 4A4-3C3
Iso type IgG1 kappa

Enviar uma mensagem


NUDT2 monoclonal antibody (M01), clone 4A4-3C3

NUDT2 monoclonal antibody (M01), clone 4A4-3C3