Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000318-D01P
NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human NUDT2 protein.
Información adicional
Size
100 ug
Gene Name
NUDT2
Gene Alias
APAH1|MGC10404
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
NUDT2 (NP_001152.1, 1 a.a. ~ 147 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
318
Enviar uma mensagem
NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*