NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000318-D01P
NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NUDT2 protein.
Información adicional
Size 100 ug
Gene Name NUDT2
Gene Alias APAH1|MGC10404
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUDT2 (NP_001152.1, 1 a.a. ~ 147 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 318

Enviar uma mensagem


NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT2 purified MaxPab rabbit polyclonal antibody (D01P)