ANXA5 purified MaxPab mouse polyclonal antibody (B01P)
  • ANXA5 purified MaxPab mouse polyclonal antibody (B01P)

ANXA5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000308-B01P
ANXA5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANXA5 protein.
Información adicional
Size 50 ug
Gene Name ANXA5
Gene Alias ANX5|ENX2|PP4
Gene Description annexin A5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANXA5 (NP_001145.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 308

Enviar uma mensagem


ANXA5 purified MaxPab mouse polyclonal antibody (B01P)

ANXA5 purified MaxPab mouse polyclonal antibody (B01P)