ANXA4 polyclonal antibody (A01)
  • ANXA4 polyclonal antibody (A01)

ANXA4 polyclonal antibody (A01)

Ref: AB-H00000307-A01
ANXA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ANXA4.
Información adicional
Size 50 uL
Gene Name ANXA4
Gene Alias ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36
Gene Description annexin A4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANXA4 (NP_001144, 224 a.a. ~ 319 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 307

Enviar uma mensagem


ANXA4 polyclonal antibody (A01)

ANXA4 polyclonal antibody (A01)