Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AMY1A monoclonal antibody (M04), clone 2D4
Abnova
AMY1A monoclonal antibody (M04), clone 2D4
Ref: AB-H00000276-M04
AMY1A monoclonal antibody (M04), clone 2D4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AMY1A.
Información adicional
Size
100 ug
Gene Name
AMY1A
Gene Alias
AMY1|AMY1B
Gene Description
amylase, alpha 1A (salivary)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq
VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AMY1A (NP_001008222, 172 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
276
Clone Number
2D4
Iso type
IgG2a Kappa
Enviar uma mensagem
AMY1A monoclonal antibody (M04), clone 2D4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*