Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AMELX monoclonal antibody (M04), clone 6G3
Abnova
AMELX monoclonal antibody (M04), clone 6G3
Ref: AB-H00000265-M04
AMELX monoclonal antibody (M04), clone 6G3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AMELX.
Información adicional
Size
100 ug
Gene Name
AMELX
Gene Alias
AIH1|ALGN|AMG|AMGL|AMGX
Gene Description
amelogenin (amelogenesis imperfecta 1, X-linked)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
265
Clone Number
6G3
Iso type
IgG2b Kappa
Enviar uma mensagem
AMELX monoclonal antibody (M04), clone 6G3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*