Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALK monoclonal antibody (M01), clone 4D10
Abnova
ALK monoclonal antibody (M01), clone 4D10
Ref: AB-H00000238-M01
ALK monoclonal antibody (M01), clone 4D10
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ALK.
Información adicional
Size
100 ug
Gene Name
ALK
Gene Alias
CD246|Ki-1|TFG/ALK
Gene Description
anaplastic lymphoma receptor tyrosine kinase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALK (NP_004295, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
238
Clone Number
4D10
Iso type
IgG1 Kappa
Enviar uma mensagem
ALK monoclonal antibody (M01), clone 4D10
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*