ALDOB polyclonal antibody (A01)
  • ALDOB polyclonal antibody (A01)

ALDOB polyclonal antibody (A01)

Ref: AB-H00000229-A01
ALDOB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ALDOB.
Información adicional
Size 50 uL
Gene Name ALDOB
Gene Alias -
Gene Description aldolase B, fructose-bisphosphate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq DSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALDOB (NP_000026, 88 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 229

Enviar uma mensagem


ALDOB polyclonal antibody (A01)

ALDOB polyclonal antibody (A01)