ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)

ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000221-D01P
ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ALDH3B1 protein.
Información adicional
Size 100 ug
Gene Name ALDH3B1
Gene Alias ALDH4|ALDH7|FLJ26433
Gene Description aldehyde dehydrogenase 3 family, member B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALDH3B1 (NP_001025181.1, 1 a.a. ~ 431 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 221

Enviar uma mensagem


ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)

ALDH3B1 purified MaxPab rabbit polyclonal antibody (D01P)