Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALDH1A1 monoclonal antibody (M01), clone 1A2
Abnova
ALDH1A1 monoclonal antibody (M01), clone 1A2
Ref: AB-H00000216-M01
ALDH1A1 monoclonal antibody (M01), clone 1A2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ALDH1A1.
Información adicional
Size
100 ug
Gene Name
ALDH1A1
Gene Alias
ALDC|ALDH-E1|ALDH1|ALDH11|MGC2318|PUMB1|RALDH1
Gene Description
aldehyde dehydrogenase 1 family, member A1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALDH1A1 (AAH01505, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
216
Clone Number
1A2
Iso type
IgG2b Kappa
Enviar uma mensagem
ALDH1A1 monoclonal antibody (M01), clone 1A2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*