ALAS2 monoclonal antibody (M02), clone 4D8
  • ALAS2 monoclonal antibody (M02), clone 4D8

ALAS2 monoclonal antibody (M02), clone 4D8

Ref: AB-H00000212-M02
ALAS2 monoclonal antibody (M02), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALAS2.
Información adicional
Size 100 ug
Gene Name ALAS2
Gene Alias ALAS-E|ALASE|ANH1|ASB|FLJ93603|XLSA
Gene Description aminolevulinate, delta-, synthase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 212
Clone Number 4D8
Iso type IgG2a Kappa

Enviar uma mensagem


ALAS2 monoclonal antibody (M02), clone 4D8

ALAS2 monoclonal antibody (M02), clone 4D8