Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALAS1 monoclonal antibody (M01), clone 3G10
Abnova
ALAS1 monoclonal antibody (M01), clone 3G10
Ref: AB-H00000211-M01
ALAS1 monoclonal antibody (M01), clone 3G10
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ALAS1.
Información adicional
Size
100 ug
Gene Name
ALAS1
Gene Alias
ALAS|ALAS3|ALASH|MIG4
Gene Description
aminolevulinate, delta-, synthase 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALAS1 (NP_000679, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
211
Clone Number
3G10
Iso type
IgG2a Kappa
Enviar uma mensagem
ALAS1 monoclonal antibody (M01), clone 3G10
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*