AK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • AK1 purified MaxPab rabbit polyclonal antibody (D01P)

AK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000203-D01P
AK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AK1 protein.
Información adicional
Size 100 ug
Gene Name AK1
Gene Alias -
Gene Description adenylate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AK1 (NP_000467.1, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 203

Enviar uma mensagem


AK1 purified MaxPab rabbit polyclonal antibody (D01P)

AK1 purified MaxPab rabbit polyclonal antibody (D01P)