AHSG MaxPab rabbit polyclonal antibody (D01)
  • AHSG MaxPab rabbit polyclonal antibody (D01)

AHSG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000197-D01
AHSG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AHSG protein.
Información adicional
Size 100 uL
Gene Name AHSG
Gene Alias A2HS|AHS|FETUA|HSGA
Gene Description alpha-2-HS-glycoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AHSG (AAH48198.1, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 197

Enviar uma mensagem


AHSG MaxPab rabbit polyclonal antibody (D01)

AHSG MaxPab rabbit polyclonal antibody (D01)