AHR monoclonal antibody (M05), clone 1D4
  • AHR monoclonal antibody (M05), clone 1D4

AHR monoclonal antibody (M05), clone 1D4

Ref: AB-H00000196-M05
AHR monoclonal antibody (M05), clone 1D4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant AHR.
Información adicional
Size 100 ug
Gene Name AHR
Gene Alias bHLHe76
Gene Description aryl hydrocarbon receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AHR (NP_001612, 279 a.a. ~ 376 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 196
Clone Number 1D4
Iso type IgG2a Kappa

Enviar uma mensagem


AHR monoclonal antibody (M05), clone 1D4

AHR monoclonal antibody (M05), clone 1D4