NR0B1 polyclonal antibody (A01)
  • NR0B1 polyclonal antibody (A01)

NR0B1 polyclonal antibody (A01)

Ref: AB-H00000190-A01
NR0B1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NR0B1.
Información adicional
Size 50 uL
Gene Name NR0B1
Gene Alias AHC|AHCH|AHX|DAX-1|DAX1|DSS|GTD|HHG|NROB1
Gene Description nuclear receptor subfamily 0, group B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 190

Enviar uma mensagem


NR0B1 polyclonal antibody (A01)

NR0B1 polyclonal antibody (A01)