Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AGER monoclonal antibody (M02), clone 1C1
Abnova
AGER monoclonal antibody (M02), clone 1C1
Ref: AB-H00000177-M02C
AGER monoclonal antibody (M02), clone 1C1
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant AGER.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size
200 uL
Gene Name
AGER
Gene Alias
MGC22357|RAGE
Gene Description
advanced glycosylation end product-specific receptor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
AQNITARIGEPLVLKCKGAPKKPPQRLEWNLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AGER (AAH20669.1, 23 a.a. ~ 404 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In condensed culture supernatant
Gene ID
177
Clone Number
1C1
Iso type
IgG2a Kappa
Enviar uma mensagem
AGER monoclonal antibody (M02), clone 1C1
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*