AEBP1 monoclonal antibody (M01), clone 1D2
  • AEBP1 monoclonal antibody (M01), clone 1D2

AEBP1 monoclonal antibody (M01), clone 1D2

Ref: AB-H00000165-M01
AEBP1 monoclonal antibody (M01), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AEBP1.
Información adicional
Size 100 ug
Gene Name AEBP1
Gene Alias ACLP|FLJ33612
Gene Description AE binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AEBP1 (NP_001120, 912 a.a. ~ 1013 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 165
Clone Number 1D2
Iso type IgG2a Kappa

Enviar uma mensagem


AEBP1 monoclonal antibody (M01), clone 1D2

AEBP1 monoclonal antibody (M01), clone 1D2