ADARB1 purified MaxPab mouse polyclonal antibody (B02P)
  • ADARB1 purified MaxPab mouse polyclonal antibody (B02P)

ADARB1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000104-B02P
ADARB1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ADARB1 protein.
Información adicional
Size 50 ug
Gene Name ADARB1
Gene Alias ADAR2|ADAR2a|ADAR2a-L1|ADAR2a-L2|ADAR2a-L3|ADAR2b|ADAR2c|ADAR2d|ADAR2g|DRABA2|DRADA2|RED1
Gene Description adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ADARB1 (NP_056648.1, 1 a.a. ~ 741 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 104

Enviar uma mensagem


ADARB1 purified MaxPab mouse polyclonal antibody (B02P)

ADARB1 purified MaxPab mouse polyclonal antibody (B02P)