ACY1 polyclonal antibody (A01)
  • ACY1 polyclonal antibody (A01)

ACY1 polyclonal antibody (A01)

Ref: AB-H00000095-A01
ACY1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ACY1.
Información adicional
Size 50 uL
Gene Name ACY1
Gene Alias ACY1D|ACYLASE
Gene Description aminoacylase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 95

Enviar uma mensagem


ACY1 polyclonal antibody (A01)

ACY1 polyclonal antibody (A01)