Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACVRL1 monoclonal antibody (M06), clone 2C12
Abnova
ACVRL1 monoclonal antibody (M06), clone 2C12
Ref: AB-H00000094-M06
ACVRL1 monoclonal antibody (M06), clone 2C12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Información adicional
Size
100 ug
Gene Name
ACVRL1
Gene Alias
ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene Description
activin A receptor type II-like 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
94
Clone Number
2C12
Iso type
IgG2a Kappa
Enviar uma mensagem
ACVRL1 monoclonal antibody (M06), clone 2C12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*