ACVR2B monoclonal antibody (M03), clone 1C11
  • ACVR2B monoclonal antibody (M03), clone 1C11

ACVR2B monoclonal antibody (M03), clone 1C11

Ref: AB-H00000093-M03
ACVR2B monoclonal antibody (M03), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACVR2B.
Información adicional
Size 100 ug
Gene Name ACVR2B
Gene Alias ACTRIIB|ActR-IIB|MGC116908
Gene Description activin A receptor, type IIB
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 93
Clone Number 1C11
Iso type IgG2a Kappa

Enviar uma mensagem


ACVR2B monoclonal antibody (M03), clone 1C11

ACVR2B monoclonal antibody (M03), clone 1C11