ACVR1B monoclonal antibody (M01), clone 2D4
  • ACVR1B monoclonal antibody (M01), clone 2D4

ACVR1B monoclonal antibody (M01), clone 2D4

Ref: AB-H00000091-M01
ACVR1B monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Información adicional
Size 100 ug
Gene Name ACVR1B
Gene Alias ACTRIB|ACVRLK4|ALK4|SKR2
Gene Description activin A receptor, type IB
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 91
Clone Number 2D4
Iso type IgG2a Kappa

Enviar uma mensagem


ACVR1B monoclonal antibody (M01), clone 2D4

ACVR1B monoclonal antibody (M01), clone 2D4