ACVR1 polyclonal antibody (A01)
  • ACVR1 polyclonal antibody (A01)

ACVR1 polyclonal antibody (A01)

Ref: AB-H00000090-A01
ACVR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACVR1.
Información adicional
Size 50 uL
Gene Name ACVR1
Gene Alias ACTRI|ACVR1A|ACVRLK2|ALK2|FOP|SKR1|TSRI
Gene Description activin A receptor, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 90

Enviar uma mensagem


ACVR1 polyclonal antibody (A01)

ACVR1 polyclonal antibody (A01)