ACADM polyclonal antibody (A01)
  • ACADM polyclonal antibody (A01)

ACADM polyclonal antibody (A01)

Ref: AB-H00000034-A01
ACADM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACADM.
Información adicional
Size 50 uL
Gene Name ACADM
Gene Alias ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH
Gene Description acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 34

Enviar uma mensagem


ACADM polyclonal antibody (A01)

ACADM polyclonal antibody (A01)