ABR polyclonal antibody (A01)
  • ABR polyclonal antibody (A01)

ABR polyclonal antibody (A01)

Ref: AB-H00000029-A01
ABR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ABR.
Información adicional
Size 50 uL
Gene Name ABR
Gene Alias FLJ45954|MDB
Gene Description active BCR-related gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABR (NP_068781, 750 a.a. ~ 859 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29

Enviar uma mensagem


ABR polyclonal antibody (A01)

ABR polyclonal antibody (A01)