ABCF1 purified MaxPab mouse polyclonal antibody (B01P)
  • ABCF1 purified MaxPab mouse polyclonal antibody (B01P)

ABCF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000023-B01P
ABCF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ABCF1 protein.
Información adicional
Size 50 ug
Gene Name ABCF1
Gene Alias ABC27|ABC50
Gene Description ATP-binding cassette, sub-family F (GCN20), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQQQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVPEEQQPALKGKKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKEKEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESKADDPYAHLSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ABCF1 (AAH34488.1, 1 a.a. ~ 845 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23

Enviar uma mensagem


ABCF1 purified MaxPab mouse polyclonal antibody (B01P)

ABCF1 purified MaxPab mouse polyclonal antibody (B01P)