NAT2 monoclonal antibody (M01), clone 3B5
  • NAT2 monoclonal antibody (M01), clone 3B5

NAT2 monoclonal antibody (M01), clone 3B5

Ref: AB-H00000010-M01
NAT2 monoclonal antibody (M01), clone 3B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NAT2.
Información adicional
Size 100 ug
Gene Name NAT2
Gene Alias AAC2|PNAT
Gene Description N-acetyltransferase 2 (arylamine N-acetyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAT2 (AAH15878, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10
Clone Number 3B5
Iso type IgG2a Kappa

Enviar uma mensagem


NAT2 monoclonal antibody (M01), clone 3B5

NAT2 monoclonal antibody (M01), clone 3B5