NAT2 MaxPab rabbit polyclonal antibody (D01)
  • NAT2 MaxPab rabbit polyclonal antibody (D01)

NAT2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000010-D01
NAT2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAT2 protein.
Información adicional
Size 100 uL
Gene Name NAT2
Gene Alias AAC2|PNAT
Gene Description N-acetyltransferase 2 (arylamine N-acetyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPQTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT2 (AAH15878.1, 1 a.a. ~ 290 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10

Enviar uma mensagem


NAT2 MaxPab rabbit polyclonal antibody (D01)

NAT2 MaxPab rabbit polyclonal antibody (D01)