NAT1 MaxPab rabbit polyclonal antibody (D01)
  • NAT1 MaxPab rabbit polyclonal antibody (D01)

NAT1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000009-D01
NAT1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAT1 protein.
Información adicional
Size 100 uL
Gene Name NAT1
Gene Alias AAC1|NATI
Gene Description N-acetyltransferase 1 (arylamine N-acetyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT1 (NP_000653.3, 1 a.a. ~ 290 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9

Enviar uma mensagem


NAT1 MaxPab rabbit polyclonal antibody (D01)

NAT1 MaxPab rabbit polyclonal antibody (D01)