A2M monoclonal antibody (M03), clone 2B5
  • A2M monoclonal antibody (M03), clone 2B5

A2M monoclonal antibody (M03), clone 2B5

Ref: AB-H00000002-M03
100 ug

Información del producto

A2M monoclonal antibody (M03), clone 2B5
Información adicional
Size 100 ug
Gene Name A2M
Gene Alias CPAMD5|DKFZp779B086|FWP007|S863-7
Gene Description alpha-2-macroglobulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen A2M (NP_000005.2, 641 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2
Clone Number 2B5
Iso type IgG2a Kappa

Enviar uma mensagem


A2M monoclonal antibody (M03), clone 2B5

A2M monoclonal antibody (M03), clone 2B5