A2M MaxPab rabbit polyclonal antibody (D01)
  • A2M MaxPab rabbit polyclonal antibody (D01)

A2M MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000002-D01
A2M MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human A2M protein.
Información adicional
Size 100 uL
Gene Name A2M
Gene Alias CPAMD5|DKFZp779B086|FWP007|S863-7
Gene Description alpha-2-macroglobulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen A2M (AAH40071.1, 1 a.a. ~ 1474 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2

Enviar uma mensagem


A2M MaxPab rabbit polyclonal antibody (D01)

A2M MaxPab rabbit polyclonal antibody (D01)